PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100002350021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 520aa    MW: 58160.8 Da    PI: 7.8278
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100002350021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-182176257
                                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                      Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                  +kR   ++ q+e+Le+++++++yps++++ +LA+++gLte+qV+ WF+ rR k+kk
  Ote100002350021|100002350021 21 KKRIVKSRAQVEALEKFYNEHKYPSESMKLQLAESIGLTEKQVSGWFCHRRLKDKK 76
                                  899***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-21476IPR009057Homeodomain-like
PROSITE profilePS5007117.071777IPR001356Homeobox domain
SuperFamilySSF466891.63E-171981IPR009057Homeodomain-like
SMARTSM003893.0E-191981IPR001356Homeobox domain
CDDcd000868.55E-172176No hitNo description
PfamPF000463.4E-162176IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MGEESCEMHP EDDKALSEKN KKRIVKSRAQ VEALEKFYNE HKYPSESMKL QLAESIGLTE  60
KQVSGWFCHR RLKDKKLMNG ENHASVRQDR SSGVIQDRGS GHRQDSCGST KQGDDKNLDT  120
REVESGRLTS KEFSAADLVY EHGSHYAGNY DRTNDASSGS SSSLRNIPPN HQNGDPSDAV  180
TSRYQIPKFP TDLKGVKTRP GPSGYLKLKG RLENPAIAAV KRQLGKHYLE DGPPLGVDFD  240
PLPPGAFESS MQDPVQDNYH SGEDVRGSPD FSNVHQNPKF RKGREYLSSM APFNSDNDGT  300
NFKTRSGFDI PDSYIHQKSR IKTSFSNSGS YYPRSNSSAE FTEGSARDIS GFGGRDEYGF  360
GRKPAVELTA MDTVQSYSNL QAYGGKLREK HAESWSRKFN DVSTRVALGE KNEYGNSNLT  420
AKRNEYHSSG DKGLSVEVIK DGKIYNNRRM INEHQVNFPH KNDTIGKKRV REEFQHQQLP  480
RATLMVDNLP HNYQVVRSAT EMPSSFSEDE ESGGTSSSVD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080403.10.0PREDICTED: uncharacterized protein LOC105163662 isoform X2
RefseqXP_012838435.10.0PREDICTED: homeotic protein proboscipedia
TrEMBLA0A022RAL20.0A0A022RAL2_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242